PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3148s0154.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 105aa    MW: 11921.8 Da    PI: 6.7978
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3148s0154.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.12.2e-1129593157
                         HHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox 31 eeLAkkl....gLterqVkvWFqNrRakekk 57
                         +e++++l    ++te++V++WFqNrRa+ k+
  Bostr.3148s0154.1.p 29 REITTELsehrHITENNVYNWFQNRRARSKR 59
                         55555555555******************97 PP

2Wus_type_Homeobox46.96.5e-1622612665
    Wus_type_Homeobox 26 tPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         t ++e  ++it+eL+e+ +i+++NV++WFQNr+aR+++kq
  Bostr.3148s0154.1.p 22 TKSAEDHREITTELSEHRHITENNVYNWFQNRRARSKRKQ 61
                         66788899******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-9964IPR009057Homeodomain-like
SuperFamilySSF466891.54E-92463IPR009057Homeodomain-like
PROSITE profilePS5007110.5442460IPR001356Homeobox domain
PfamPF000461.1E-82859IPR001356Homeobox domain
CDDcd000864.51E-63461No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MDSNDDATSD SREHLQGRKW NTKSAEDHRE ITTELSEHRH ITENNVYNWF QNRRARSKRK  60
QPHKTTMIGQ SNDAAVTTEE RSCGDSGGFG SYQHILFPSS DLGQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15260RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306476.12e-36hypothetical protein CARUB_v10012447mg
SwissprotQ9LM845e-37WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLR0IAB32e-36R0IAB3_9BRAS; Uncharacterized protein
STRINGAT1G20700.11e-34(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.13e-38WUSCHEL related homeobox 14